Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid Peptide (1-42), rat

β-Amyloid (1-42), rat is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Solubility

DMSO: 50mg/mL

Molecular Weight

4418.05

Notes

For research use only.

AA Sequence

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TTYH3 Antibody
NBP1-91350 100 µL

Rabbit Polyclonal TTYH3 Antibody

Sign In for Pricing
View Details
Lentiviral human APOO shRNA (UAS) - Lentiviral human APOO shRNA (UAS, GFP) plasmid
GTR15136618 1 Vial

Lentiviral human APOO shRNA (UAS) - Lentiviral human APOO shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal HLA DRB1 Antibody (HLA-DRB/1067) [DyLight 680]
NBP2-47671FR 0.1 mL

Mouse Monoclonal HLA DRB1 Antibody (HLA-DRB/1067) [DyLight 680]

Sign In for Pricing
View Details
ARMC8 (Armadillo Repeat-containing Protein 8, S863-2, DKFZP434A043, HSPC056, MGC10058, MGC4880) (MaxLight 550)
MBS6210279-01 0.1 mL

ARMC8 (Armadillo Repeat-containing Protein 8, S863-2, DKFZP434A043, HSPC056, MGC10058, MGC4880) (MaxLight 550)

Sign In for Pricing
View Details
ARMC8 (Armadillo Repeat-containing Protein 8, S863-2, DKFZP434A043, HSPC056, MGC10058, MGC4880) (MaxLight 550)
MBS6210279-02 5x 0.1 mL

ARMC8 (Armadillo Repeat-containing Protein 8, S863-2, DKFZP434A043, HSPC056, MGC10058, MGC4880) (MaxLight 550)

Sign In for Pricing
View Details
ICK Antibody
MBS8583073-01 0.1 mL

ICK Antibody

Sign In for Pricing
View Details