Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid β-Protein (42-1)

Aβ 1-42, 42-residue fragment of amyloid precursor protein, has been found to be a major constituent of the senile plaques formed in the brains of patients with Alzheimer’s disease and late Down’s syndrome. Aβ 1-42 readily forms neurotoxic oligomers at physiological pH. On the other hand, the peptide shows antimicrobial activity. The sequence of this peptide corresponds to the sequence of human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ42. The peptide has been used to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer’s disease patients through fluorescence correlation spectroscopy. For detailed descriptions of the preparation of Aβ 1-42 monomers and protofibrils please see the papers of Jan, Hartley, and Lashuel, Stine et al. (2011), and of Broersen and colleagues. The findings of Ryan et al. indicate that 10% ammonia disaggregates Aβ42 more efficiently than HFIP.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4514.14

Notes

For research use only.

AA Sequence

AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cux2 Polyclonal Antibody, Cy3 Conjugated
bs-11832R-Cy3 100 µL

Cux2 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Eotaxin/CCL11 Rabbit Polyclonal Antibody (Fluoro550)
orb3078993 100 µg

Eotaxin/CCL11 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
NEDL1 (h) -PR
sc-89511-PR 10 µM - 20 µL

NEDL1 (h) -PR

Sign In for Pricing
View Details
Karacolidine
TN8690-01 10 mg

Karacolidine

Sign In for Pricing
View Details
Karacolidine
TN8690-02 50 mg

Karacolidine

Sign In for Pricing
View Details
(2S) -2-Amino-6- (((1- (6-nitrobenzo[d][1,3]dioxol-5-yl) ethoxy) carbonyl) amino) hexanoic acid
OR1074293-01 25 mg

(2S) -2-Amino-6- (((1- (6-nitrobenzo[d][1,3]dioxol-5-yl) ethoxy) carbonyl) amino) hexanoic acid

Sign In for Pricing
View Details