Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (40-1)

β-Amyloid (40-1) is areverse version of β-Amyloid (1-40) .

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4329.9

Notes

For research use only.

AA Sequence

VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRELID1 Protein Vector (Mouse) (pPB-C-His)
PV219070 500 ng

PRELID1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Sensor protein CutS (cutS)
orb2925093-01 20 µg

Recombinant Sensor protein CutS (cutS)

Sign In for Pricing
View Details
Recombinant Sensor protein CutS (cutS)
orb2925093-02 100 µg

Recombinant Sensor protein CutS (cutS)

Sign In for Pricing
View Details
MKRN2
CSB-CL872420HU 10 μg Plasmid + 200 μL Glycerol

MKRN2

Sign In for Pricing
View Details
Pre-mRNA-splicing Factor SYF2 (SYF2) Rat ELISA Kit
G0696 96 Tests

Pre-mRNA-splicing Factor SYF2 (SYF2) Rat ELISA Kit

Sign In for Pricing
View Details
BBS12 Protein Vector (Mouse) (pPB-C-His)
PV158402 500 ng

BBS12 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details