Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (40-1)

β-Amyloid (40-1) is areverse version of β-Amyloid (1-40) .

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4329.9

Notes

For research use only.

AA Sequence

VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R15A (Protein Phosphatase 1, Regulatory Subunit 15A, PPP1-R15A, PPP1R15-A, PPP1-R15-A, GADD34, Growth Arrest And DNA-Damage-Inducible 34, Myeloid differentiation primary response protein MyD116 homolog)
364734 200 µL

PPP1R15A (Protein Phosphatase 1, Regulatory Subunit 15A, PPP1-R15A, PPP1R15-A, PPP1-R15-A, GADD34, Growth Arrest And DNA-Damage-Inducible 34, Myeloid differentiation primary response protein MyD116 homolog)

Sign In for Pricing
View Details
CD320 siRNA (Mouse)
CRM5479-01 15 nmol

CD320 siRNA (Mouse)

Sign In for Pricing
View Details
CD320 siRNA (Mouse)
CRM5479-02 30 nmol

CD320 siRNA (Mouse)

Sign In for Pricing
View Details
Sox3 Protein Vector (Mouse) (pPB-N-His)
PV232791 500 ng

Sox3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-CD36 Antibody (Ona Thera Patent Anti-Cd36)
F1937-.1 100 µg

Anti-CD36 Antibody (Ona Thera Patent Anti-Cd36)

Sign In for Pricing
View Details
Polyclonal Antibody to Pyruvate Kinase, Muscle (PKM2)
MBS2002822-01 0.1 mL

Polyclonal Antibody to Pyruvate Kinase, Muscle (PKM2)

Sign In for Pricing
View Details