Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-49)

β-amyloid (1-49) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

5254.1

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)
MBS2071052-01 0.1 mL

APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)
MBS2071052-02 0.2 mL

APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)
MBS2071052-03 0.5 mL

APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)
MBS2071052-04 1 mL

APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)
MBS2071052-05 5 mL

APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)
MBS2071052-06 5x 5 mL

APC-Linked Polyclonal Antibody to Interleukin 17 Receptor B (IL17RB)

Sign In for Pricing
View Details