Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-49)

β-amyloid (1-49) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

5254.1

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGF-AA Recombinant Protein
40-157-001mg 0.01 mg

PDGF-AA Recombinant Protein

Sign In for Pricing
View Details
Anti-DNAJC9 Antibody Picoband® Fluoro647 Conjugated
A10730-2-Fluoro647 100 µg/Vial

Anti-DNAJC9 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
SH2D2A Antibody
MBS9215645-01 0.1 mL

SH2D2A Antibody

Sign In for Pricing
View Details
SH2D2A Antibody
MBS9215645-02 5x 0.1 mL

SH2D2A Antibody

Sign In for Pricing
View Details
Bt-176 MAIZE (blank) 1 g
ERM-BF411a 1 g

Bt-176 MAIZE (blank) 1 g

Sign In for Pricing
View Details
LCN8 Rabbit Polyclonal Antibody (PE)
orb492622 100 µL

LCN8 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details