Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid β/A4 Protein Precursor770 (740-770)

Amyloid β/A4 Protein Precursor770 (740-770) corresponds to a C-terminal amyloid precursor protein (APP) fragment known as C31. This fragment is intracellularly generated by proteolytic cleavage of APP by caspases-8 and -9. C31 had a proapoptotic and a cytotoxic effect on neuronal cells and was shown to be present in brains of Alzheimer's disease (AD) patients. In cultured cells caspase cleavage of APP was induced by amyloid β-protein and the subsequent generation of C31 contributed to the apoptotic cell death associated with amyloid β-protein. Amyloid precursor binding protein BP1 (APP-BP1) a cell cycle protein which is increased in AD brain was demonstrated to bind to the C31 region of APP and to mediate APP-induced apoptosis.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3717.14

Notes

For research use only.

AA Sequence

AAVTPEERHLSKMQQNGYENPTYKFFEQMQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α-Ketoglutaric Acid
41100000-2 500 g

α-Ketoglutaric Acid

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) AROA Polyclonal Antibody
MBS7184361 Inquire

Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) AROA Polyclonal Antibody

Sign In for Pricing
View Details
Pigeon TSH-Stimulation Blocking Antibody (Anti-TSB) ELISA Kit
MBS9911970 Inquire

Pigeon TSH-Stimulation Blocking Antibody (Anti-TSB) ELISA Kit

Sign In for Pricing
View Details
FCGBP Protein Vector (Mouse) (pPM-C-HA)
PV178952 500 ng

FCGBP Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PION Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
36706064 1.0 µg DNA

PION Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Guinea pig S100 Calcium Binding Protein A6 (S100A6) ELISA Kit
abx250135 96 Well

Guinea pig S100 Calcium Binding Protein A6 (S100A6) ELISA Kit

Sign In for Pricing
View Details