Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid β/A4 Protein Precursor770 (740-770)

Amyloid β/A4 Protein Precursor770 (740-770) corresponds to a C-terminal amyloid precursor protein (APP) fragment known as C31. This fragment is intracellularly generated by proteolytic cleavage of APP by caspases-8 and -9. C31 had a proapoptotic and a cytotoxic effect on neuronal cells and was shown to be present in brains of Alzheimer's disease (AD) patients. In cultured cells caspase cleavage of APP was induced by amyloid β-protein and the subsequent generation of C31 contributed to the apoptotic cell death associated with amyloid β-protein. Amyloid precursor binding protein BP1 (APP-BP1) a cell cycle protein which is increased in AD brain was demonstrated to bind to the C31 region of APP and to mediate APP-induced apoptosis.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3717.14

Notes

For research use only.

AA Sequence

AAVTPEERHLSKMQQNGYENPTYKFFEQMQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cln3 ORF Vector (Mouse) (pORF)
ORF041585 1.0 µg DNA

Cln3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RBP1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1800704 1.0 µg DNA

RBP1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Lysophosphatidic acid receptor 2 (LPAR2), partial
MBS7055286 Inquire

Recombinant Macaca fascicularis Lysophosphatidic acid receptor 2 (LPAR2), partial

Sign In for Pricing
View Details
VIPR1 Antibody
MBS9411760-01 0.1 mL

VIPR1 Antibody

Sign In for Pricing
View Details
VIPR1 Antibody
MBS9411760-02 5x 0.1 mL

VIPR1 Antibody

Sign In for Pricing
View Details
N, N-Diallyl-5-methoxytryptamine
271819-01 50 g

N, N-Diallyl-5-methoxytryptamine

Sign In for Pricing
View Details