Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid β/A4 Protein Precursor770 (740-770)

Amyloid β/A4 Protein Precursor770 (740-770) corresponds to a C-terminal amyloid precursor protein (APP) fragment known as C31. This fragment is intracellularly generated by proteolytic cleavage of APP by caspases-8 and -9. C31 had a proapoptotic and a cytotoxic effect on neuronal cells and was shown to be present in brains of Alzheimer's disease (AD) patients. In cultured cells caspase cleavage of APP was induced by amyloid β-protein and the subsequent generation of C31 contributed to the apoptotic cell death associated with amyloid β-protein. Amyloid precursor binding protein BP1 (APP-BP1) a cell cycle protein which is increased in AD brain was demonstrated to bind to the C31 region of APP and to mediate APP-induced apoptosis.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3717.14

Notes

For research use only.

AA Sequence

AAVTPEERHLSKMQQNGYENPTYKFFEQMQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spastin Double Nickase Plasmid (m)
sc-424512-NIC 20 µg

Spastin Double Nickase Plasmid (m)

Sign In for Pricing
View Details
PLD1 Antibody
15-865 100 µL

PLD1 Antibody

Sign In for Pricing
View Details
BID (NM_197967) Human Tagged ORF Clone Lentiviral Particle
RC221674L4V 200 µL

BID (NM_197967) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HRB Rabbit Polyclonal Antibody (HRP)
orb2125424 100 µL

HRB Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
DAB2IP Protein Vector (Human) (pPM-C-His)
PV072156 500 ng

DAB2IP Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ROM1 Rabbit pAb
MBS8537905-01 0.1 mL

ROM1 Rabbit pAb

Sign In for Pricing
View Details