Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Gln22] -β- Amyloid (1 - 40)

(Gln22) β-Amyloid (1-40) human is an amyloid beta protein (Aβ) -containing peptide used in Alzheimer's disease research.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4328.91

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF740 conjugate, 0.1mg/mL
BNC742103-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
d4-Succinic Acid
TRC-S688793-1G 1 g

d4-Succinic Acid

Sign In for Pricing
View Details
SHCBP1 Rabbit Polyclonal Antibody
TA366689 100 µL

SHCBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Strep-A-Chek Kit
13-050-00 1 Each

Strep-A-Chek Kit

Sign In for Pricing
View Details
GSK3 beta Recombinant Rabbit monoclonal Antibody
HA750131 100 µL

GSK3 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SIRT5 Antibody
OC-674-01 50 μL

SIRT5 Antibody

Sign In for Pricing
View Details