Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Gly22] -β- Amyloid (1 - 40)

[Gly22] -β- Amyloid (1 - 40) (Arctic variant Ab40ARC (E22G) ) is a peptide. [Gly22] -β- Amyloid (1 - 40) can be used for the research of Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4257.83

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Procollagen I C-Terminal Propeptide (PICP) ELISA KIT
EIA06229h 1 Kit

Human Procollagen I C-Terminal Propeptide (PICP) ELISA KIT

Sign In for Pricing
View Details
FXN / Frataxin Rabbit pAb
E45R23718N 50 ul

FXN / Frataxin Rabbit pAb

Sign In for Pricing
View Details
Fmoc-NH-PEG6-CH2CH2COOH
BA2407-5000 5 g

Fmoc-NH-PEG6-CH2CH2COOH

Sign In for Pricing
View Details
C1orf114 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
14122111 3x 1.0 µg

C1orf114 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Iron-sulfur cluster repair protein ScdA (scdA)
MBS1047242-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Iron-sulfur cluster repair protein ScdA (scdA)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Iron-sulfur cluster repair protein ScdA (scdA)
MBS1047242-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Iron-sulfur cluster repair protein ScdA (scdA)

Sign In for Pricing
View Details