Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cys-β- Amyloid (1 - 40)

Cys-β- Amyloid (1 - 40) can be easily and selectively modified, labeled, coupled to carriers e.g. by maleimide chemistry without affecting the sequences involved in fibril formation. The free mercapto moiety of the peptide adheres to gold surfaces.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4432.03

Notes

For research use only.

AA Sequence

CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Deoxycholic Acid Impurity 57
RM-D221057-01 10 mg

Deoxycholic Acid Impurity 57

Sign In for Pricing
View Details
Deoxycholic Acid Impurity 57
RM-D221057-02 25 mg

Deoxycholic Acid Impurity 57

Sign In for Pricing
View Details
Deoxycholic Acid Impurity 57
RM-D221057-03 50 mg

Deoxycholic Acid Impurity 57

Sign In for Pricing
View Details
Deoxycholic Acid Impurity 57
RM-D221057-04 100 mg

Deoxycholic Acid Impurity 57

Sign In for Pricing
View Details
FAM184B (h) -PR
sc-88874-PR 10 µM - 20 µL

FAM184B (h) -PR

Sign In for Pricing
View Details
Sendai Virus Nucleoprotein (324-332)
orb372813-01 1 mg

Sendai Virus Nucleoprotein (324-332)

Sign In for Pricing
View Details