Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cys-β- Amyloid (1 - 40)

Cys-β- Amyloid (1 - 40) can be easily and selectively modified, labeled, coupled to carriers e.g. by maleimide chemistry without affecting the sequences involved in fibril formation. The free mercapto moiety of the peptide adheres to gold surfaces.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4432.03

Notes

For research use only.

AA Sequence

CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl36 Mouse shRNA Plasmid (Locus ID 54217)
TL503007 1 Kit

Rpl36 Mouse shRNA Plasmid (Locus ID 54217)

Sign In for Pricing
View Details
Lentiviral human SLC2A10 sgRNA gene knockout kit - Lentiviral human SLC2A10 sgRNA gene knockout kit (100)
GTR15397960 1 Vial

Lentiviral human SLC2A10 sgRNA gene knockout kit - Lentiviral human SLC2A10 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Anti-TAP2 Antibody
MBS178054-01 0.01 mg

Anti-TAP2 Antibody

Sign In for Pricing
View Details
Anti-TAP2 Antibody
MBS178054-02 0.1 mg (Carrier Free)

Anti-TAP2 Antibody

Sign In for Pricing
View Details
Anti-TAP2 Antibody
MBS178054-03 0.1 mg

Anti-TAP2 Antibody

Sign In for Pricing
View Details
Anti-TAP2 Antibody
MBS178054-04 0.1 mg (Cy3)

Anti-TAP2 Antibody

Sign In for Pricing
View Details