Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cys-β- Amyloid (1 - 40)

Cys-β- Amyloid (1 - 40) can be easily and selectively modified, labeled, coupled to carriers e.g. by maleimide chemistry without affecting the sequences involved in fibril formation. The free mercapto moiety of the peptide adheres to gold surfaces.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4432.03

Notes

For research use only.

AA Sequence

CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF12 Rabbit pAb
MBS9146203-01 0.02 mL

TAF12 Rabbit pAb

Sign In for Pricing
View Details
TAF12 Rabbit pAb
MBS9146203-02 0.1 mL

TAF12 Rabbit pAb

Sign In for Pricing
View Details
TAF12 Rabbit pAb
MBS9146203-03 5x 0.1 mL

TAF12 Rabbit pAb

Sign In for Pricing
View Details
Proplyenebis(Isothiocyanate)
TRC-P288890-100MG 100 mg

Proplyenebis(Isothiocyanate)

Sign In for Pricing
View Details
C10orf58 3'UTR Luciferase Stable Cell Line
TU002676 1.0 mL

C10orf58 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RGD1359158 ORF Vector (Rat) (pORF)
39170016 1.0 µg DNA

RGD1359158 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details