Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Gly22]-Amyloid β-Protein (1-42)

(Gly22) -Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ) . Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. Mutation of Glu22 to Gly22 in Aβ can increase aggregation.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4442.07

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFB1M Antibody, Biotin conjugated
A36422-100UG 100 µg

TFB1M Antibody, Biotin conjugated

Sign In for Pricing
View Details
BNIP3 (Bcl2/Adenovirus E1B 19kD Protein-Interacting Protein 3, 19kD Interacting Protein 3, NIP3)
MBS610584-01 0.1 mL

BNIP3 (Bcl2/Adenovirus E1B 19kD Protein-Interacting Protein 3, 19kD Interacting Protein 3, NIP3)

Sign In for Pricing
View Details
BNIP3 (Bcl2/Adenovirus E1B 19kD Protein-Interacting Protein 3, 19kD Interacting Protein 3, NIP3)
MBS610584-02 5x 0.1 mL

BNIP3 (Bcl2/Adenovirus E1B 19kD Protein-Interacting Protein 3, 19kD Interacting Protein 3, NIP3)

Sign In for Pricing
View Details
EN2, CT-2 (Homeobox Protein Engrailed-2, Homeobox Protein en-2, Hu-En-2) (Biotin) discontinued
E2270-10C-Biotin 200 µL

EN2, CT-2 (Homeobox Protein Engrailed-2, Homeobox Protein en-2, Hu-En-2) (Biotin) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal WDR35 Antibody [Alexa Fluor 700]
NBP2-82058AF700 0.1 mL

Rabbit Polyclonal WDR35 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Bpnt1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
13441116 3x 1.0 µg

Bpnt1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details