Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Gly22]-Amyloid β-Protein (1-42)

(Gly22) -Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ) . Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. Mutation of Glu22 to Gly22 in Aβ can increase aggregation.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4442.07

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CETN2 Protein (N-His, Human)
P502472 100 µg

CETN2 Protein (N-His, Human)

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (rAURKB/1592), CF640R conjugate, 0.1mg/mL
BNC403787-100 1x 100 µL

Aurora B (Proliferation Marker) (rAURKB/1592), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rabbit Monoclonal Histone H2AY/macroH2A.1 Antibody (248)
NBP2-61494 100 µg

Rabbit Monoclonal Histone H2AY/macroH2A.1 Antibody (248)

Sign In for Pricing
View Details
Dmrtc1c Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
18325066 1.0 µg DNA

Dmrtc1c Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
STAT3 Antibody (C-term S727)
MBS9207609-01 0.08 mL

STAT3 Antibody (C-term S727)

Sign In for Pricing
View Details
STAT3 Antibody (C-term S727)
MBS9207609-02 0.4 mL

STAT3 Antibody (C-term S727)

Sign In for Pricing
View Details