Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Gly22]-Amyloid β-Protein (1-42)

(Gly22) -Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ) . Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. Mutation of Glu22 to Gly22 in Aβ can increase aggregation.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4442.07

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2,3-Dimethoxypyridin-4-yl) pivalamide
456977-01 25 mg

N- (2,3-Dimethoxypyridin-4-yl) pivalamide

Sign In for Pricing
View Details
N- (2,3-Dimethoxypyridin-4-yl) pivalamide
456977-02 50 mg

N- (2,3-Dimethoxypyridin-4-yl) pivalamide

Sign In for Pricing
View Details
CPSF2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0502006 1.0 µg DNA

CPSF2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Goat Anti Human IgG+IgM+IgA-AbFluor 633
SA0875-01 100 µL

Goat Anti Human IgG+IgM+IgA-AbFluor 633

Sign In for Pricing
View Details
Goat Anti Human IgG+IgM+IgA-AbFluor 633
SA0875-02 1 mL

Goat Anti Human IgG+IgM+IgA-AbFluor 633

Sign In for Pricing
View Details
LRP8 Antibody
A39607-100UG 100 µg

LRP8 Antibody

Sign In for Pricing
View Details