Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cecropin B, Free Acid

Cecropin B (free acid) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

3834.73

Notes

For research use only.

AA Sequence

KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau (S305) Antibody (Biotin)
KB-116-01 50 μL

Tau (S305) Antibody (Biotin)

Sign In for Pricing
View Details
Tau (S305) Antibody (Biotin)
KB-116-02 100 µL

Tau (S305) Antibody (Biotin)

Sign In for Pricing
View Details
Tau (S305) Antibody (Biotin)
KB-116-03 1 mL

Tau (S305) Antibody (Biotin)

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF568 conjugate, 0.1mg/mL
BNC681930-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP90AA1 Human Gene Knockout Kit (CRISPR)
KN212496LP 1 Kit

HSP90AA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS-CoV-2 Spike Trimer Protein, His Tag (BA.2.74/Omicron) (MALS verified)
SPN-C522h-50ug 50 µg

SARS-CoV-2 Spike Trimer Protein, His Tag (BA.2.74/Omicron) (MALS verified)

Sign In for Pricing
View Details