Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cecropin B, Free Acid

Cecropin B (free acid) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

3834.73

Notes

For research use only.

AA Sequence

KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2S,3S)-2,3-Butanediol
TRC-B692445-500MG 500 mg

(2S,3S)-2,3-Butanediol

Sign In for Pricing
View Details
Recombinant Human SIGLEC2/CD22 Protein (aa 176-687, His Tag)
PKSH030957 100 µg

Recombinant Human SIGLEC2/CD22 Protein (aa 176-687, His Tag)

Sign In for Pricing
View Details
Recombinant Human CD131/CSF2RB Protein (His Tag)
PKSH031555 100 µg

Recombinant Human CD131/CSF2RB Protein (His Tag)

Sign In for Pricing
View Details
SET (NM_003011) Human Over-expression Lysate
LY401059 100 µg

SET (NM_003011) Human Over-expression Lysate

Sign In for Pricing
View Details
KCTD9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F11]
TA807663BM 100 µL

KCTD9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F11]

Sign In for Pricing
View Details
n-Undecanoyl Chloride
TRC-U788870-500MG 500 mg

n-Undecanoyl Chloride

Sign In for Pricing
View Details