Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cecropin B, Free Acid

Cecropin B (free acid) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

3834.73

Notes

For research use only.

AA Sequence

KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201592) Human Recombinant Protein
TP313529 20 µg

Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201592) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Salivary gland
CS639149 5x 5 µm

Frozen Tissue Sections, Salivary gland

Sign In for Pricing
View Details
4-Chloronitrobenzene-13C6
TRC-C373917-2.5MG 2.5 mg

4-Chloronitrobenzene-13C6

Sign In for Pricing
View Details
CT45A6 (NM_001017438) Human Over-expression Lysate
LC422735 20 µg

CT45A6 (NM_001017438) Human Over-expression Lysate

Sign In for Pricing
View Details
XPNPEP2 Antibody
OC-499-01 50 μL

XPNPEP2 Antibody

Sign In for Pricing
View Details
XPNPEP2 Antibody
OC-499-02 100 µL

XPNPEP2 Antibody

Sign In for Pricing
View Details