Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Gln11] -β- Amyloid (1 - 40)

[Gln11] -β- Amyloid (1 - 40)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4328.91

Notes

For research use only.

AA Sequence

DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), Biotin conjugate, 0.1mg/mL
BNCB2226-500 1x 500 µL

FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
H6PD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A7]
TA501257BM 100 µL

H6PD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A7]

Sign In for Pricing
View Details
p21 Mouse Monoclonal Antibody [A8C11]
HA601018 100 µL

p21 Mouse Monoclonal Antibody [A8C11]

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF405S conjugate, 0.1mg/mL
BNC041893-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (V92.1), CF405S conjugate, 0.1mg/mL
BNC040680-100 1x 100 µL

Cyclin B1 (V92.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GBE1 Human Gene Knockout Kit (CRISPR)
KN204152LP 1 Kit

GBE1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details