Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Val35] -β - Amyloid (1 - 42)

[Val35] -β - Amyloid (1 - 42)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4482.07

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLVVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP9 Rabbit Polyclonal Antibody
TA367170 100 µL

MMP9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SFRP4 Recombinant Rabbit Monoclonal Antibody [JE41-41]
ET7109-27 100 µL

SFRP4 Recombinant Rabbit Monoclonal Antibody [JE41-41]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB523191 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB526793 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
CD82 Mouse Monoclonal Antibody [Clone ID: B-L2]
AM31359PU-N 2 mL (200 Tests)

CD82 Mouse Monoclonal Antibody [Clone ID: B-L2]

Sign In for Pricing
View Details
MRPS14 (NM_022100) Human Over-expression Lysate
LC402904 20 µg

MRPS14 (NM_022100) Human Over-expression Lysate

Sign In for Pricing
View Details