Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Val35] -β - Amyloid (1 - 42)

[Val35] -β - Amyloid (1 - 42)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4482.07

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLVVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(2-Hydroxy-4-nitrophenyl)phthalimide
TRC-H948690-250MG 250 mg

N-(2-Hydroxy-4-nitrophenyl)phthalimide

Sign In for Pricing
View Details
5Alpha-Dihydrocortisol 21-Acetate
TRC-D448855-5MG 5 mg

5Alpha-Dihydrocortisol 21-Acetate

Sign In for Pricing
View Details
ARPC2 Recombinant Rabbit Monoclonal Antibody [JE58-79]
HA720030 100 µL

ARPC2 Recombinant Rabbit Monoclonal Antibody [JE58-79]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504706 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Muscle Specific Actin (MSA/953), CF405S conjugate, 0.1mg/mL
BNC040953-500 1x 500 µL

Muscle Specific Actin (MSA/953), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LTBR Mouse Monoclonal Antibody [Clone ID: OTI3G10]
CF805712 100 µg

LTBR Mouse Monoclonal Antibody [Clone ID: OTI3G10]

Sign In for Pricing
View Details