Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Val35] -β - Amyloid (1 - 42)

[Val35] -β - Amyloid (1 - 42)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4482.07

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLVVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAGE1 Mouse Monoclonal Antibody [Clone ID: OTI10E7]
CF805726 100 µg

PAGE1 Mouse Monoclonal Antibody [Clone ID: OTI10E7]

Sign In for Pricing
View Details
Human FOXR2 activation kit by CRISPRa
GA115347 1 Kit

Human FOXR2 activation kit by CRISPRa

Sign In for Pricing
View Details
Fast EvaGreen® Master Mix for qPCR, trial size (100 rxn)
#31003-T 1x 1 mL

Fast EvaGreen® Master Mix for qPCR, trial size (100 rxn)

Sign In for Pricing
View Details
OR2M3 Antibody
8G561-AAT 50 µg

OR2M3 Antibody

Sign In for Pricing
View Details
SCN3B Human Gene Knockout Kit (CRISPR)
KN423114 1 Kit

SCN3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ELTD1 Antibody
8G100-AAT 50 µg

ELTD1 Antibody

Sign In for Pricing
View Details