What is the catalog number for β- Amyloid (1-33)?

The catalog number for β- Amyloid (1-33) is orb2693253.

What sizes are available for β- Amyloid (1-33)?

β- Amyloid (1-33) is available in the following size(s): 5 mg, 10 mg.

How many pack sizes does β- Amyloid (1-33) come in?

β- Amyloid (1-33) is available in 2 different pack sizes.

Is β- Amyloid (1-33) in stock?

β- Amyloid (1-33) is currently made to order / not held in immediate stock. Contact us for lead time.

β- Amyloid (1-33)

β-Amyloid (1-33) is a β-Amyloid peptide consists of 33 amino acid.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3674.03

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JOT-EK0123HO-01 96 Well

Horse Hepcidin,HAMP ELISA KIT

Sign In for Pricing

View Details

JOT-EK0123HO-02 48 Well

Horse Hepcidin,HAMP ELISA KIT

Sign In for Pricing

View Details

abx511865 96 Tests

Dog Mast/Stem Cell Growth Factor Receptor Kit (KIT) ELISA Kit

Sign In for Pricing

View Details

sc-409139-LAC-2 200 µL

PCDHGA10 Lentiviral Activation Particles (h2)

Sign In for Pricing

View Details

MPC4733K Each

Magic™ Membrane Protein Human SMIM4 (Small integral membrane protein 4) Full Length

Sign In for Pricing

View Details

MBS7014571-01 0.02 mg

Recombinant Pongo abelii Protein FAM18B1 (FAM18B1)

Sign In for Pricing

View Details