What is the catalog number for β- Amyloid (1-33)?

The catalog number for β- Amyloid (1-33) is orb2693253.

What sizes are available for β- Amyloid (1-33)?

β- Amyloid (1-33) is available in the following size(s): 5 mg, 10 mg.

How many pack sizes does β- Amyloid (1-33) come in?

β- Amyloid (1-33) is available in 2 different pack sizes.

Is β- Amyloid (1-33) in stock?

β- Amyloid (1-33) is currently made to order / not held in immediate stock. Contact us for lead time.

β- Amyloid (1-33)

β-Amyloid (1-33) is a β-Amyloid peptide consists of 33 amino acid.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3674.03

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K4671302 1.0 µg DNA

Ccdc76 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing

View Details

orb1515136 500 µg

ERC2 Antibody Blocking Peptide

Sign In for Pricing

View Details

YHE49101 100 μg

Recombinant Human RPL5 Protein, N-His

Sign In for Pricing

View Details

K1979608 1.0 µg DNA

RPL36AP10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing

View Details

PLAC8-3276R 50 µg

Recombinant Rhesus Macaque PLAC8 Protein, His (Fc)-Avi-tagged

Sign In for Pricing

View Details

sc-219053 5 mg

N-Benzyl-dibenzazepinone-d4

Sign In for Pricing

View Details