What is the catalog number for β- Amyloid (1-33)?

The catalog number for β- Amyloid (1-33) is orb2693253.

What sizes are available for β- Amyloid (1-33)?

β- Amyloid (1-33) is available in the following size(s): 5 mg, 10 mg.

How many pack sizes does β- Amyloid (1-33) come in?

β- Amyloid (1-33) is available in 2 different pack sizes.

Is β- Amyloid (1-33) in stock?

β- Amyloid (1-33) is currently made to order / not held in immediate stock. Contact us for lead time.

β- Amyloid (1-33)

β-Amyloid (1-33) is a β-Amyloid peptide consists of 33 amino acid.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3674.03

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HY-RS02560 1 Set

CFDP1 Human Pre-designed siRNA Set A

Sign In for Pricing

View Details

H0762 96 Tests

SICAM-1/CD54/CD54 (Soluble Intercellular Antercellular Molecule 1) Human ELISA Kit

Sign In for Pricing

View Details

sc-401557-ACT 20 µg

HnRNP E1 CRISPR Activation Plasmid (h)

Sign In for Pricing

View Details

PV016802 500 ng

FTL Protein Vector (Human) (pPB-N-His)

Sign In for Pricing

View Details

49445021 500 ng

VCL Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing

View Details

IMP-629 20 µg

Recombinant Human PDCD1 protein, His Tag

Sign In for Pricing

View Details