Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β- Amyloid (1-34)

β-Amyloid (1-34) is a β-Amyloid peptide consists of 34 amino acid.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3787.2

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VE-Cadherin Antibody [K17A2]
C15757-100uL*2 2x 100μL

VE-Cadherin Antibody [K17A2]

Sign In for Pricing
View Details
Human Cbp/p300 interacting transactivator 1 (CITED1) ELISA Kit
MBS7203687-01 48 Well

Human Cbp/p300 interacting transactivator 1 (CITED1) ELISA Kit

Sign In for Pricing
View Details
Human Cbp/p300 interacting transactivator 1 (CITED1) ELISA Kit
MBS7203687-02 96 Well

Human Cbp/p300 interacting transactivator 1 (CITED1) ELISA Kit

Sign In for Pricing
View Details
Human Cbp/p300 interacting transactivator 1 (CITED1) ELISA Kit
MBS7203687-03 5x 96 Well

Human Cbp/p300 interacting transactivator 1 (CITED1) ELISA Kit

Sign In for Pricing
View Details
Human Cbp/p300 interacting transactivator 1 (CITED1) ELISA Kit
MBS7203687-04 10x 96 Well

Human Cbp/p300 interacting transactivator 1 (CITED1) ELISA Kit

Sign In for Pricing
View Details
Sephs1 3'UTR GFP Stable Cell Line
TU270125 1.0 mL

Sephs1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details