Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β- Amyloid (1-37)

β- Amyloid (1-37) is a β-Amyloid peptide consists of 37 amino acid.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4074.58

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBG1/2 (11Q19) Rabbit Monoclonal Antibody
E28M5153 100 µL

HBG1/2 (11Q19) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Sephs1 Mouse qPCR Template Standard (NM_175400)
MK202052 1 Kit

Sephs1 Mouse qPCR Template Standard (NM_175400)

Sign In for Pricing
View Details
B7H4 Polyclonal Antibody, APC-Cy7 Conjugated
bs-0673R-APC-Cy7 100 µL

B7H4 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
S-100 α chain CRISPR Activation Plasmid (m2)
sc-422777-ACT-2 20 µg

S-100 α chain CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
PS7-CTD Peptide
MBS516477-01 1 mg

PS7-CTD Peptide

Sign In for Pricing
View Details
PS7-CTD Peptide
MBS516477-02 5x 1 mg

PS7-CTD Peptide

Sign In for Pricing
View Details