Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β- Amyloid (1-38)

β- Amyloid (1-38) is a β-Amyloid peptide consists of 38 amino acid.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4131.63

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycocholic acid (hydrate)
HY-N1423B 100 mg

Glycocholic acid (hydrate)

Sign In for Pricing
View Details
MT-ND6 Rabbit Polyclonal Antibody (APC)
orb994174 100 µL

MT-ND6 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
HER3/ErbB3 Antibody [N12M8]
C18448-20uL 20 µL

HER3/ErbB3 Antibody [N12M8]

Sign In for Pricing
View Details
NF-kB p65 (Nuclear Factor kB) (MaxLight 490)
N2303-05-ML490 100 µL

NF-kB p65 (Nuclear Factor kB) (MaxLight 490)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Eosinophil Chemotactic Factor (ECF)
MBS2035326-01 0.1 mL

APC-Linked Polyclonal Antibody to Eosinophil Chemotactic Factor (ECF)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Eosinophil Chemotactic Factor (ECF)
MBS2035326-02 0.2 mL

APC-Linked Polyclonal Antibody to Eosinophil Chemotactic Factor (ECF)

Sign In for Pricing
View Details