Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β- Amyloid (1-38)

β- Amyloid (1-38) is a β-Amyloid peptide consists of 38 amino acid.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4131.63

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 3 (Caspase-3, CASP 3, CASP3, CASP-3, CPP-32, Apopain, Yama, SCA-1, ASP3, Apoptosis-related Cysteine Peptidase Apopain, Apopain, Cysteine Protease CPP32, SREBP Cleavage Activity 1, Yama, Yama Protein) (APC) discontinued
C2087-01R-APC 100 µL

Caspase 3 (Caspase-3, CASP 3, CASP3, CASP-3, CPP-32, Apopain, Yama, SCA-1, ASP3, Apoptosis-related Cysteine Peptidase Apopain, Apopain, Cysteine Protease CPP32, SREBP Cleavage Activity 1, Yama, Yama Protein) (APC) discontinued

Sign In for Pricing
View Details
Lentiviral human ANKRD26 shRNA (UAS) - Lentiviral human ANKRD26 shRNA (UAS) plasmid
GTR15325942 1 Vial

Lentiviral human ANKRD26 shRNA (UAS) - Lentiviral human ANKRD26 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CSNK1G2 Recombinant Protein (Rat)
RP196523 100 µg

CSNK1G2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
SHB antibody
70R-5789 100 µL

SHB antibody

Sign In for Pricing
View Details
Caprisil Diol HPLC Column, 3 µm, 100 Å, CC533-D x 150 mm
CC433-D 3 µm

Caprisil Diol HPLC Column, 3 µm, 100 Å, CC533-D x 150 mm

Sign In for Pricing
View Details
CYP2D6 3'UTR GFP Stable Cell Line
TU055458 1.0 mL

CYP2D6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details