Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β- Amyloid (1-38)

β- Amyloid (1-38) is a β-Amyloid peptide consists of 38 amino acid.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4131.63

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+) -Kavain
T4590-01 50 mg

(+) -Kavain

Sign In for Pricing
View Details
(+) -Kavain
T4590-02 1 mL - 10 mM (in DMSO)

(+) -Kavain

Sign In for Pricing
View Details
(+) -Kavain
T4590-03 10 mg

(+) -Kavain

Sign In for Pricing
View Details
(+) -Kavain
T4590-04 25 mg

(+) -Kavain

Sign In for Pricing
View Details
NLRP3 Human Over-expression Lysate
orb1363972 20 µg

NLRP3 Human Over-expression Lysate

Sign In for Pricing
View Details
Hsa-miR-491-5p mimic
HY-R01466-01 5 nmol

Hsa-miR-491-5p mimic

Sign In for Pricing
View Details