β-Amyloid (1-38), mouse, rat
β-Amyloid (1-38), mouse, rat is composed of 38 aa (1-38 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.
Product Specifications
Field of Research
Neuroscience
Purity
≥95%
Molecular Weight
4035.5
Notes
For research use only.
AA Sequence
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M4700-06E1-AP 100 µL
Mucin 1 (Mucin-1, MUC1, MUC-1, Breast Carcinoma-associated Antigen DF3, Carcinoma Associated Mucin, CD227, DF3, Episialin, Epithelial Membrane Antigen, EMA, H23 Antigen, H23AG, HGNC:7508, KL-6, MAM6, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, PEMT, Tumor Associated Epithelial Membrane Antigen, Tumor-associated Mucin) (AP) discontinued
Sign In for Pricing
View Details 
