Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-38), mouse, rat

β-Amyloid (1-38), mouse, rat is composed of 38 aa (1-38 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4035.5

Notes

For research use only.

AA Sequence

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Amhr2 shRNA (UAS) - Lentiviral mouse Amhr2 shRNA (UAS) plasmid
GTR15264055 1 Vial

Lentiviral mouse Amhr2 shRNA (UAS) - Lentiviral mouse Amhr2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Fam188a-set siRNA/shRNA/RNAi Lentivector (Mouse)
19873094 4x 500 ng

Fam188a-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
PHLDB1 ORF Vector (Human) (pORF)
36603011 1.0 µg DNA

PHLDB1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
HMGA1 (D6A4) XP® Rabbit Monoclonal Antibody
CST 7777S 100 µL

HMGA1 (D6A4) XP® Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BV2 (DMEM) Cell Complete Medium
MBS2576510 4x 125 mL

BV2 (DMEM) Cell Complete Medium

Sign In for Pricing
View Details
Canine A-kinase anchor protein 14 (AKAP14) ELISA Kit
MBS7214869-01 48 Well

Canine A-kinase anchor protein 14 (AKAP14) ELISA Kit

Sign In for Pricing
View Details