What is the catalog number for β-Amyloid (11- 40)?

The catalog number for β-Amyloid (11- 40) is orb2693239.

What sizes are available for β-Amyloid (11- 40)?

β-Amyloid (11- 40) is available in the following size(s): 5 mg, 10 mg.

How many pack sizes does β-Amyloid (11- 40) come in?

β-Amyloid (11- 40) is available in 2 different pack sizes.

Is β-Amyloid (11- 40) in stock?

β-Amyloid (11- 40) is currently made to order / not held in immediate stock. Contact us for lead time.

β-Amyloid (11- 40)

β-Amyloid (11- 40) is a peptide fragment of β-Amyloid.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3151.71

Notes

For research use only.

AA Sequence

EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

19750094 4x 500 ng

Fam126b-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing

View Details

AM31247AF-N 200 µg

TIE2 (TEK) Mouse Monoclonal Antibody [Clone ID: B-B48]

Sign In for Pricing

View Details

MR214347 10 µg

Olfr782 (NM_001011797) Mouse Tagged ORF Clone

Sign In for Pricing

View Details

47502 100 µL

MYCT1 Antibody

Sign In for Pricing

View Details

K1337907 1.0 µg DNA

MRPS33 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing

View Details

MBS7237240-01 48 Well

Chicken Complement C1q tumor necrosis factor-related protein 7 (C1QTNF7) ELISA Kit

Sign In for Pricing

View Details