β-Amyloid (11- 40)
β-Amyloid (11- 40) is a peptide fragment of β-Amyloid.
Product Specifications
Field of Research
Neuroscience
Purity
≥95%
Molecular Weight
3151.71
Notes
For research use only.
AA Sequence
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9940907-01 48 Well
Hamster Isopentenyl-Diphosphate Delta-Isomerase 1 (IDI1) ELISA Kit
Sign In for Pricing
View Details 
MBS9940907-02 96 Well
Hamster Isopentenyl-Diphosphate Delta-Isomerase 1 (IDI1) ELISA Kit
Sign In for Pricing
View Details MBS9940907-03 5x 96 Well
Hamster Isopentenyl-Diphosphate Delta-Isomerase 1 (IDI1) ELISA Kit
Sign In for Pricing
View Details MBS9940907-04 10x 96 Well
Hamster Isopentenyl-Diphosphate Delta-Isomerase 1 (IDI1) ELISA Kit
Sign In for Pricing
View Details