What is the catalog number for β-Amyloid (11- 40)?

The catalog number for β-Amyloid (11- 40) is orb2693239.

What sizes are available for β-Amyloid (11- 40)?

β-Amyloid (11- 40) is available in the following size(s): 5 mg, 10 mg.

How many pack sizes does β-Amyloid (11- 40) come in?

β-Amyloid (11- 40) is available in 2 different pack sizes.

Is β-Amyloid (11- 40) in stock?

β-Amyloid (11- 40) is currently made to order / not held in immediate stock. Contact us for lead time.

β-Amyloid (11- 40)

β-Amyloid (11- 40) is a peptide fragment of β-Amyloid.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3151.71

Notes

For research use only.

AA Sequence

EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROTQ96GX5 20 µg

MASTL (NM_032844) Human Recombinant Protein

Sign In for Pricing

View Details

sc-60332 10 µM

CARD 6 siRNA (h)

Sign In for Pricing

View Details

orb2938504 100 µg

Zebrafish FSHB Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing

View Details

C8454-14X-APC 100 µL

Cyclin D2 (BSA & Azide Free) (APC) discontinued

Sign In for Pricing

View Details

orb2806103 100 µg

Synaptotagmin-12/SYT12/12 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing

View Details

orb644732-01 25 µL

Shb (phospho-Y246) polyclonal antibody

Sign In for Pricing

View Details