Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

γ-TAC4 (30 - 61) - NH2

γ-TAC4 (30 - 61) - NH2

Product Specifications

Purity

≥95%

Molecular Weight

3481.96

Notes

For research use only.

AA Sequence

TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PE/Cyanine7 CD24 (Rabbit, Monoclonal)
A118756 100 µL

Anti-PE/Cyanine7 CD24 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
2- (2,4-dioxo-1,3-diazaspiro[4.4]non-3-yl) ethanesulfonyl fluoride
sc-339599 250 mg

2- (2,4-dioxo-1,3-diazaspiro[4.4]non-3-yl) ethanesulfonyl fluoride

Sign In for Pricing
View Details
Triflupromazine hydrochloride
B1993-500 500 mg

Triflupromazine hydrochloride

Sign In for Pricing
View Details
Human EMILIN 1 (Elastin Microfibril Interface Located Protein 1) ELISA Kit
EKF60368 96 Tests

Human EMILIN 1 (Elastin Microfibril Interface Located Protein 1) ELISA Kit

Sign In for Pricing
View Details
Anti-SOX9 Antibody Picoband® Fluoro647 Conjugated
A00177-2-Fluoro647 100 µg/Vial

Anti-SOX9 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Anti-Nesprin 1 Rabbit mAb
CMA6011-01 30 µL

Recombinant Anti-Nesprin 1 Rabbit mAb

Sign In for Pricing
View Details