γ-TAC4 (30 - 61) - NH2
γ-TAC4 (30 - 61) - NH2
Product Specifications
Purity
≥95%
Molecular Weight
3481.96
Notes
For research use only.
AA Sequence
TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
042869-ML750 100 µL
TLE6, NT (TLE6, Transducin-like enhancer protein 6) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
P10270R 1000 Units/Pack
Non-printed with Looped Cap Screw Cap Tube, Conical, PP, 2.0 mL, with EPDM ring Cap, Red - 1000 un, DNase/RNase free - ABDOS
Sign In for Pricing
View Details 
A03357-3-Dylight594 100 µg
Anti-MNT Antibody Picoband®, Dylight594 Conjugate
Sign In for Pricing
View Details