Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

γ-TAC4 (30 - 61) - NH2

γ-TAC4 (30 - 61) - NH2

Product Specifications

Purity

≥95%

Molecular Weight

3481.96

Notes

For research use only.

AA Sequence

TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cystatin A Antibody (CPTC-CSTA-1) [Alexa Fluor 350]
NBP3-08498AF350 100 µL

Mouse Monoclonal Cystatin A Antibody (CPTC-CSTA-1) [Alexa Fluor 350]

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C21orf67 (C21orf67)
MBS967222-01 0.02 mg (E-Coli)

Recombinant Human Uncharacterized protein C21orf67 (C21orf67)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C21orf67 (C21orf67)
MBS967222-02 0.1 mg (E-Coli)

Recombinant Human Uncharacterized protein C21orf67 (C21orf67)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C21orf67 (C21orf67)
MBS967222-03 0.02 mg (Yeast)

Recombinant Human Uncharacterized protein C21orf67 (C21orf67)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C21orf67 (C21orf67)
MBS967222-04 0.1 mg (Yeast)

Recombinant Human Uncharacterized protein C21orf67 (C21orf67)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C21orf67 (C21orf67)
MBS967222-05 0.02 mg (Baculovirus)

Recombinant Human Uncharacterized protein C21orf67 (C21orf67)

Sign In for Pricing
View Details