γ-TAC4 (30 - 61) - NH2
γ-TAC4 (30 - 61) - NH2
Product Specifications
Purity
≥95%
Molecular Weight
3481.96
Notes
For research use only.
AA Sequence
TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E28PB3887 100 µL
LgA (13Q9) Mouse Monoclonal Antibody (Center) (Ascites)
Sign In for Pricing
View Details 
028-06B 5 mg
Glucagon (22-29) (Human, Rat, Mouse, Porcine, Bovine, Canine)
Sign In for Pricing
View Details 
MBS2147699-01 0.1 mL
APC-Linked Monoclonal Antibody to Cluster Of Differentiation 5 (CD5)
Sign In for Pricing
View Details MBS2147699-02 0.2 mL
APC-Linked Monoclonal Antibody to Cluster Of Differentiation 5 (CD5)
Sign In for Pricing
View Details MBS2147699-03 0.5 mL
APC-Linked Monoclonal Antibody to Cluster Of Differentiation 5 (CD5)
Sign In for Pricing
View Details