Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid Dan Protein (1-34)

Amyloid Dan Protein (1-34)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4044.63

Notes

For research use only.

AA Sequence

{Pyr}-ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY (Disulfide bridge:Cys5-Cys21)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS704274 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF488A conjugate, 0.1mg/mL
BNC881960-500 1x 500 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IRF7 (C-term) Rabbit Polyclonal Antibody
AP07762PU-N 50 µg

IRF7 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GAD1/2 Antibody
8C0201-AAT 50 µg

GAD1/2 Antibody

Sign In for Pricing
View Details
SynCAM (CADM1) (NM_014333) Human Recombinant Protein
TP315477 20 µg

SynCAM (CADM1) (NM_014333) Human Recombinant Protein

Sign In for Pricing
View Details
3-Hydroxy Benzopyrene
TRC-H829400-1MG 1 mg

3-Hydroxy Benzopyrene

Sign In for Pricing
View Details