Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid Dan Protein (1-34)

Amyloid Dan Protein (1-34)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4044.63

Notes

For research use only.

AA Sequence

{Pyr}-ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY (Disulfide bridge:Cys5-Cys21)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BLOC1S3 activation kit by CRISPRa
GA117965 1 Kit

Human BLOC1S3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Colon: left
CR560419 5 µg

Tissue Total RNA, Colon: left

Sign In for Pricing
View Details
PE Anti-Human/Mouse IL-5 Antibody[TRFK5]
E-AB-F1205UD-01 25 µg

PE Anti-Human/Mouse IL-5 Antibody[TRFK5]

Sign In for Pricing
View Details
PE Anti-Human/Mouse IL-5 Antibody[TRFK5]
E-AB-F1205UD-02 100 µg

PE Anti-Human/Mouse IL-5 Antibody[TRFK5]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB537568 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
CAPS2 Antibody
KC-43119-01 50 μL

CAPS2 Antibody

Sign In for Pricing
View Details