Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Arg3]-Amyloid β-Protein (1-40)

[Arg3]-Amyloid β-Protein (1-40)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4356.97

Notes

For research use only.

AA Sequence

DARFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibroblast Growth Factor-13, Fgf-13 Elisa Kit
EKC41068 96 Tests

Human Fibroblast Growth Factor-13, Fgf-13 Elisa Kit

Sign In for Pricing
View Details
TRNAV20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV754369 1.0 µg DNA

TRNAV20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
QFlamma® Black01 Azide
QWZ1001_5 mg 5 mg

QFlamma® Black01 Azide

Sign In for Pricing
View Details
SLC24A4 antibody - N-terminal region (ARP44134_P050)
ARP44134_P050 100 µL

SLC24A4 antibody - N-terminal region (ARP44134_P050)

Sign In for Pricing
View Details
5-Hydroxytryptamine Receptor 1D (HTR1D) Porcine ELISA Kit
B1049 96 Tests

5-Hydroxytryptamine Receptor 1D (HTR1D) Porcine ELISA Kit

Sign In for Pricing
View Details
ACTH (7-23) Polyclonal Antibody, Cy3 Conjugated
bs-0004R-Cy3 100 µL

ACTH (7-23) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details