Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Arg3]-Amyloid β-Protein (1-40)

[Arg3]-Amyloid β-Protein (1-40)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4356.97

Notes

For research use only.

AA Sequence

DARFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DDC siRNA
abx913738-01 15 nmol

Mouse DDC siRNA

Sign In for Pricing
View Details
Mouse DDC siRNA
abx913738-02 30 nmol

Mouse DDC siRNA

Sign In for Pricing
View Details
Anti-PGRMC1 Antibody (R2T33)
RHA07501 100 μg

Anti-PGRMC1 Antibody (R2T33)

Sign In for Pricing
View Details
Human PTGER4 full length protein-synthetic nanodisc
orb1743174-01 10 µg

Human PTGER4 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human PTGER4 full length protein-synthetic nanodisc
orb1743174-02 50 µg

Human PTGER4 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human PTGER4 full length protein-synthetic nanodisc
orb1743174-03 100 µg

Human PTGER4 full length protein-synthetic nanodisc

Sign In for Pricing
View Details