Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Gln9]-Amyloid β-Protein (1-40)

[Gln9]-Amyloid β-Protein (1-40)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4400.98

Notes

For research use only.

AA Sequence

DAEFRHDSQYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFRKB Antibody
8C17081-AAT 50 µg

NFRKB Antibody

Sign In for Pricing
View Details
Mouse Rpl18 activation kit by CRISPRa
GA203683 1 Kit

Mouse Rpl18 activation kit by CRISPRa

Sign In for Pricing
View Details
Cardboard Freezer Boxes
R2700 5 Units/Pack

Cardboard Freezer Boxes

Sign In for Pricing
View Details
CF®750-Dextran 40,000 MW, Anionic and Fixable
#80128 1x 1 mg

CF®750-Dextran 40,000 MW, Anionic and Fixable

Sign In for Pricing
View Details
S6K1 (RPS6KB1) Human Gene Knockout Kit (CRISPR)
KN417324 1 Kit

S6K1 (RPS6KB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HIDE1 (C19orf38) (Center) Rabbit Polyclonal Antibody
AP50512PU-N 400 µL

HIDE1 (C19orf38) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details