Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[D-Asp1]-Amyloid- β-Protein (1-42)

(D-Asp1) -Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ) . Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4514.14

Notes

For research use only.

AA Sequence

{D-Asp}-EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, Basic (Type II, HMW) (HRP)
MBS6124154-01 0.1 mL

Cytokeratin, Basic (Type II, HMW) (HRP)

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II, HMW) (HRP)
MBS6124154-02 5x 0.1 mL

Cytokeratin, Basic (Type II, HMW) (HRP)

Sign In for Pricing
View Details
Anti-GSTM3 Polyclonal Antibody
HB042014-01 50 µg

Anti-GSTM3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GSTM3 Polyclonal Antibody
HB042014-02 100 µg

Anti-GSTM3 Polyclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-105-5p miRNA Antagomir
orb1916269-01 10 nmol

Hsa-miR-105-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-105-5p miRNA Antagomir
orb1916269-02 20 nmol

Hsa-miR-105-5p miRNA Antagomir

Sign In for Pricing
View Details