Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[D-Asp1]-Amyloid- β-Protein (1-42)

(D-Asp1) -Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ) . Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4514.14

Notes

For research use only.

AA Sequence

{D-Asp}-EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gdf2 3'UTR Luciferase Stable Cell Line
TU106992 1.0 mL

Gdf2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rho GTPase activating protein 29 (ARHGAP29) Human qPCR Template Standard (NM_004815)
HK209576 1 Kit

Rho GTPase activating protein 29 (ARHGAP29) Human qPCR Template Standard (NM_004815)

Sign In for Pricing
View Details
genesig Std Real-time PCR detection kit for Marburgvirus
Z-Path-MBGV-std 150 Tests

genesig Std Real-time PCR detection kit for Marburgvirus

Sign In for Pricing
View Details
GTF3C2 Protein Vector (Rat) (pPB-C-His)
PV271946 500 ng

GTF3C2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. SsrA-binding protein (smpB)
MBS1214823-01 0.02 mg (E-Coli)

Recombinant Magnetococcus sp. SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. SsrA-binding protein (smpB)
MBS1214823-02 0.1 mg (E-Coli)

Recombinant Magnetococcus sp. SsrA-binding protein (smpB)

Sign In for Pricing
View Details