Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-43) (human)

β-Amyloid (1-43) (human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43) (human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43) (human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4615.24

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf122 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
53884111 3x 1.0 µg

C9orf122 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human MCM8 Protein, N-His
orb2965480-01 50 µg

Recombinant Human MCM8 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MCM8 Protein, N-His
orb2965480-02 100 µg

Recombinant Human MCM8 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MCM8 Protein, N-His
orb2965480-03 1 mg

Recombinant Human MCM8 Protein, N-His

Sign In for Pricing
View Details
GGN Rabbit Polyclonal Antibody (BF680)
orb2525378 100 µL

GGN Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
1- (3- (difluoromethyl) -2-methylphenyl) propan-1-one
PC1013015 1 Each

1- (3- (difluoromethyl) -2-methylphenyl) propan-1-one

Sign In for Pricing
View Details