Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-43) (human)

β-Amyloid (1-43) (human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43) (human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43) (human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4615.24

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-NECTIN1-3×FLAG-Neo Plasmid
PVT63393 2 µg

pCMV-NECTIN1-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details
KPNA1 Rabbit Polyclonal Antibody (BF555)
orb2380489 100 µL

KPNA1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
C12orf26 (METTL25) Mouse Monoclonal Antibody [Clone ID: OTI1B1]
TA507325S 30 µL

C12orf26 (METTL25) Mouse Monoclonal Antibody [Clone ID: OTI1B1]

Sign In for Pricing
View Details
CRHR1 Protein Vector (Mouse) (pPM-C-His)
PV168017 500 ng

CRHR1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
BTBD1 (A-12)
sc-398235 200 µg/mL

BTBD1 (A-12)

Sign In for Pricing
View Details
UTS2 (Urotensin-2, UII, U-II, UCN2, PRO1068) discontinued
214094-01 20 µL

UTS2 (Urotensin-2, UII, U-II, UCN2, PRO1068) discontinued

Sign In for Pricing
View Details