Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-43) (human)

β-Amyloid (1-43) (human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43) (human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43) (human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4615.24

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Rb RB1 Rabbit Monoclonal Antibody, Carrier-free
M00039-2-carrier-free 100 µL

Anti-Rb RB1 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Panobinostat (LBH589)
C07451-10mg 10 mg

Panobinostat (LBH589)

Sign In for Pricing
View Details
Clk1 sgRNA CRISPR Lentivector set (Mouse)
K4545601 3x 1.0 µg

Clk1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Elmo1 (m) : 293T Lysate
sc-120003 100 µg - 200 µL

Elmo1 (m) : 293T Lysate

Sign In for Pricing
View Details
GSK3532795 1mg
A17178-1 1 mg

GSK3532795 1mg

Sign In for Pricing
View Details
DHX37 (NM_032656) Human Untagged Clone
SC104313 10 µg

DHX37 (NM_032656) Human Untagged Clone

Sign In for Pricing
View Details